Lineage for d2x2aa_ (2x2a A:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 959125Fold b.62: Cyclophilin-like [50890] (1 superfamily)
    barrel, closed; n=8, S=10; complex topology
  4. 959126Superfamily b.62.1: Cyclophilin-like [50891] (5 families) (S)
  5. 959127Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins)
  6. 959128Protein Cyclophilin (eukaryotic) [50893] (13 species)
  7. 959143Species Human (Homo sapiens), variant A [TaxId:9606] [50894] (56 PDB entries)
    Uniprot P05092
  8. 959146Domain d2x2aa_: 2x2a A: [169818]
    automated match to d1ak4a_
    complexed with gol, so4

Details for d2x2aa_

PDB Entry: 2x2a (more details), 1.4 Å

PDB Description: free acetyl-cypa trigonal form
PDB Compounds: (A:) Peptidyl-prolyl cis-trans isomerase A

SCOPe Domain Sequences for d2x2aa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2x2aa_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Human (Homo sapiens), variant A [TaxId: 9606]}
mvnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgf
mcqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictaktk
wldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle

SCOPe Domain Coordinates for d2x2aa_:

Click to download the PDB-style file with coordinates for d2x2aa_.
(The format of our PDB-style files is described here.)

Timeline for d2x2aa_: