Lineage for d2x1wb_ (2x1w B:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3033576Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
    disulfide-rich fold; common core is all-beta
  4. 3033577Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) (S)
  5. 3033932Family g.17.1.0: automated matches [191392] (1 protein)
    not a true family
  6. 3033933Protein automated matches [190506] (3 species)
    not a true protein
  7. 3033934Species Human (Homo sapiens) [TaxId:9606] [187459] (39 PDB entries)
  8. 3033964Domain d2x1wb_: 2x1w B: [169808]
    automated match to d1katv_
    complexed with cs, nag

Details for d2x1wb_

PDB Entry: 2x1w (more details), 2.7 Å

PDB Description: crystal structure of vegf-c in complex with domains 2 and 3 of vegfr2
PDB Compounds: (B:) vascular endothelial growth factor c

SCOPe Domain Sequences for d2x1wb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2x1wb_ g.17.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eilksidnewrktqcmprevaidvgkefgvatntffkppcvsvyrcggccnseglqcmnt
stsylsktlfeitvplsqgpkpvtisfanhtscrcmsk

SCOPe Domain Coordinates for d2x1wb_:

Click to download the PDB-style file with coordinates for d2x1wb_.
(The format of our PDB-style files is described here.)

Timeline for d2x1wb_: