SCOPe 2.06: Domain d2x1wa_: 2x1w A:

Lineage for d2x1wa_ (2x1w A:)

1. Root: SCOPe 2.06

2. Class g: Small proteins [56992] (94 folds)

3. Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
   disulfide-rich fold; common core is all-beta

4. Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families)

5. Family g.17.1.0: automated matches [191392] (1 protein)
   not a true family

6. Protein automated matches [190506] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187459] (23 PDB entries)

8. Domain d2x1wa_: 2x1w A: [169807]
   automated match to d1katv_
   complexed with cs, nag

Details for d2x1wa_

PDB Entry: 2x1w, 2.7 Å

PDB Description: crystal structure of vegf-c in complex with domains 2 and 3 of vegfr2

PDB Compounds: (A:) vascular endothelial growth factor c

SCOPe Domain Sequences for d2x1wa_:

Sequence; same for both SEQRES and ATOM records:

>d2x1wa_ g.17.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
teilksidnewrktqcmprevaidvgkefgvatntffkppcvsvyrcggccnseglqcmn
tstsylsktlfeitvplsqgpkpvtisfanhtscrcms

Timeline for d2x1wa_:

• d2x1wa_ first appeared in SCOPe 2.01
  
• d2x1wa_ appears in SCOPe 2.05
  
• d2x1wa_ appears in SCOPe 2.07
  
• d2x1wa_ appears in the current release, SCOPe 2.08