Class g: Small proteins [56992] (94 folds) |
Fold g.17: Cystine-knot cytokines [57500] (1 superfamily) disulfide-rich fold; common core is all-beta |
Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) |
Family g.17.1.0: automated matches [191392] (1 protein) not a true family |
Protein automated matches [190506] (3 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187459] (23 PDB entries) |
Domain d2x1wa_: 2x1w A: [169807] automated match to d1katv_ complexed with cs, nag |
PDB Entry: 2x1w (more details), 2.7 Å
SCOPe Domain Sequences for d2x1wa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2x1wa_ g.17.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} teilksidnewrktqcmprevaidvgkefgvatntffkppcvsvyrcggccnseglqcmn tstsylsktlfeitvplsqgpkpvtisfanhtscrcms
Timeline for d2x1wa_: