Lineage for d2x1rb_ (2x1r B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2089715Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (2 families) (S)
  5. 2089716Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (2 proteins)
    automatically mapped to Pfam PF00121
  6. 2089717Protein Triosephosphate isomerase [51353] (20 species)
  7. 2089953Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [51357] (41 PDB entries)
  8. 2089977Domain d2x1rb_: 2x1r B: [169799]
    automated match to d1dkwa_
    complexed with so4, x1r

Details for d2x1rb_

PDB Entry: 2x1r (more details), 1.98 Å

PDB Description: crystallographic binding studies with an engineered monomeric variant of triosephosphate isomerase
PDB Compounds: (B:) Triosephosphate isomerase, glycosomal

SCOPe Domain Sequences for d2x1rb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2x1rb_ c.1.1.1 (B:) Triosephosphate isomerase {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
skpqpiaaanwksgspdslselidlfnstsinhdvqcvvastfvhlamtkerlshpkfvi
aaqnagnadalaslkdfgvnwivlghserrwyygetneivadkvaaavasgfmviacige
tlqeresgrtavvvltqiaaiakklkkadwakvviayepvwaigtgkvatpqqaqeahal
irswvsskigadvagelrilyggsvngknartlyqqrdvngflaglkpefvdiikatq

SCOPe Domain Coordinates for d2x1rb_:

Click to download the PDB-style file with coordinates for d2x1rb_.
(The format of our PDB-style files is described here.)

Timeline for d2x1rb_: