Lineage for d2x1pd_ (2x1p D:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 929300Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 929301Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 931683Protein automated matches [190119] (11 species)
    not a true protein
  7. 931767Species Llama (Lama glama) [TaxId:9844] [187485] (12 PDB entries)
  8. 931770Domain d2x1pd_: 2x1p D: [169795]
    automated match to d1zmya1

Details for d2x1pd_

PDB Entry: 2x1p (more details), 1.1 Å

PDB Description: gelsolin nanobody
PDB Compounds: (D:) gelsolin nanobody

SCOPe Domain Sequences for d2x1pd_:

Sequence, based on SEQRES records: (download)

>d2x1pd_ b.1.1.1 (D:) automated matches {Llama (Lama glama) [TaxId: 9844]}
qlqesggglvqaggslrlscaasgrtftsfamgwfrqapgkerefvasisrsgtltryad
sakgrftisvdnakntvslqmdnlnpddtavyycaadlhrpygpgtqrsdeydswgqgtq
vtvs

Sequence, based on observed residues (ATOM records): (download)

>d2x1pd_ b.1.1.1 (D:) automated matches {Llama (Lama glama) [TaxId: 9844]}
qlqesggglvqaggslrlscaasfamgwfrqapgkerefvasisrsgtltryadsakgrf
tisvdnakntvslqmdnlnpddtavyycaadlhrpygpgtqrsdeydswgqgtqvtvs

SCOPe Domain Coordinates for d2x1pd_:

Click to download the PDB-style file with coordinates for d2x1pd_.
(The format of our PDB-style files is described here.)

Timeline for d2x1pd_: