SCOPe 2.08: Domain d2x1ob1: 2x1o B:6-121

Lineage for d2x1ob1 (2x1o B:6-121)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Llama (Lama glama) [TaxId:9844] [187485] (245 PDB entries)

8. Domain d2x1ob1: 2x1o B:6-121 [169794]
   Other proteins in same PDB: d2x1oa2, d2x1ob2
   automated match to d1g9ea_

Details for d2x1ob1

PDB Entry: 2x1o, 1.34 Å

PDB Description: gelsolin nanobody

PDB Compounds: (B:) gelsolin nanobody

SCOPe Domain Sequences for d2x1ob1:

Sequence; same for both SEQRES and ATOM records:

>d2x1ob1 b.1.1.1 (B:6-121) automated matches {Llama (Lama glama) [TaxId: 9844]}
esggglvqaggslrlscaaagrnlrmyrmgwfrqapgkerefvgtmvwssdtiyyadsvk
grfiisrdnakntvylqmnslkpedtavyycaagagwagtmtdynywgqgtqvtvs

Timeline for d2x1ob1:

• d2x1ob1 first appeared in SCOPe 2.01, called d2x1ob_
  
• d2x1ob1 appears in SCOPe 2.07