Lineage for d2x18h_ (2x18 H:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 957214Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 957215Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 957216Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (48 proteins)
    Pfam PF00169
  6. 957450Protein automated matches [190063] (2 species)
    not a true protein
  7. 957451Species Human (Homo sapiens) [TaxId:9606] [187187] (6 PDB entries)
  8. 957459Domain d2x18h_: 2x18 H: [169789]
    automated match to d1unqa_
    complexed with epe

Details for d2x18h_

PDB Entry: 2x18 (more details), 1.46 Å

PDB Description: the crystal structure of the ph domain of human akt3 protein kinase
PDB Compounds: (H:) rac-gamma serine/threonine-protein kinase

SCOPe Domain Sequences for d2x18h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2x18h_ b.55.1.1 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dvtivkegwvqkrgeyiknwrpryfllktdgsfigykekpqdvdlpyplnnfsvakcqlm
kterpkpntfiirclqwttviertfhvdtpeereewteaiqavadrlqrqeeermn

SCOPe Domain Coordinates for d2x18h_:

Click to download the PDB-style file with coordinates for d2x18h_.
(The format of our PDB-style files is described here.)

Timeline for d2x18h_: