Class b: All beta proteins [48724] (174 folds) |
Fold b.55: PH domain-like barrel [50728] (2 superfamilies) barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix |
Superfamily b.55.1: PH domain-like [50729] (14 families) |
Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (48 proteins) Pfam PF00169 |
Protein automated matches [190063] (2 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187187] (6 PDB entries) |
Domain d2x18d_: 2x18 D: [169785] automated match to d1unqa_ complexed with epe |
PDB Entry: 2x18 (more details), 1.46 Å
SCOPe Domain Sequences for d2x18d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2x18d_ b.55.1.1 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]} vtivkegwvqkrgeyiknwrpryfllktdgsfigykekpqdvdlpyplnnfsvakcqlmk terpkpntfiirclqwttviertfhvdtpeereewteaiqavadrlqrqeeermn
Timeline for d2x18d_: