![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.55: PH domain-like barrel [50728] (2 superfamilies) barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix |
![]() | Superfamily b.55.1: PH domain-like [50729] (14 families) ![]() |
![]() | Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (48 proteins) Pfam PF00169 |
![]() | Protein automated matches [190063] (3 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187187] (8 PDB entries) |
![]() | Domain d2x18b_: 2x18 B: [169783] automated match to d1unqa_ complexed with epe |
PDB Entry: 2x18 (more details), 1.46 Å
SCOPe Domain Sequences for d2x18b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2x18b_ b.55.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} vtivkegwvqkrgeyiknwrpryfllktdgsfigykekpqdvdlpyplnnfsvakcqlmk terpkpntfiirclqwttviertfhvdtpeereewteaiqavadrlqrqeeerm
Timeline for d2x18b_: