Lineage for d1f4na_ (1f4n A:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 767812Fold a.30: ROP-like [47379] (8 superfamilies)
    4 helices; dimer of identical alpha-hairpin subunits; bundle, closed, left-handed twist
  4. 767813Superfamily a.30.1: ROP protein [47380] (1 family) (S)
  5. 767814Family a.30.1.1: ROP protein [47381] (1 protein)
  6. 767815Protein ROP protein [47382] (1 species)
  7. 767816Species Escherichia coli [TaxId:562] [47383] (12 PDB entries)
    Uniprot P03051
  8. 767830Domain d1f4na_: 1f4n A: [16978]
    a multiple mutant with a repacked hydrophobic core and a new dimerization mode

Details for d1f4na_

PDB Entry: 1f4n (more details), 1.9 Å

PDB Description: c2 crystal structure of ala2ile2-6, a version of rop with a repacked hydrophobic core and a new fold.
PDB Compounds: (A:) rop ala2ile2-6

SCOP Domain Sequences for d1f4na_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f4na_ a.30.1.1 (A:) ROP protein {Escherichia coli [TaxId: 562]}
gtkqektilnmarfirsqaltilekaneldadeiadiaesihdhadeiyrsalarfgddg

SCOP Domain Coordinates for d1f4na_:

Click to download the PDB-style file with coordinates for d1f4na_.
(The format of our PDB-style files is described here.)

Timeline for d1f4na_:

767830
d1f4na_ in context of PDB
View in 3D
Domains from other chains:
(mouse over for more information)
d1f4nb_