![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.8: The 'swivelling' beta/beta/alpha domain [52008] (10 superfamilies) 3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology this domain is thought to be mobile in most multi-domain proteins known to contain it |
![]() | Superfamily c.8.1: Phosphohistidine domain [52009] (3 families) ![]() contains barrel, closed, n=7, S=10 |
![]() | Family c.8.1.1: Pyruvate phosphate dikinase, central domain [52010] (1 protein) |
![]() | Protein Pyruvate phosphate dikinase, central domain [52011] (3 species) |
![]() | Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [75134] (1 PDB entry) |
![]() | Domain d2x0sa2: 2x0s A:406-537 [169775] Other proteins in same PDB: d2x0sa1, d2x0sa3 |
PDB Entry: 2x0s (more details), 3 Å
SCOPe Domain Sequences for d2x0sa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2x0sa2 c.8.1.1 (A:406-537) Pyruvate phosphate dikinase, central domain {Trypanosome (Trypanosoma brucei) [TaxId: 5691]} pnlepgaekankpigrglaaspgaavgqvvfdaesakewsgrgkkvimvrletspedlag mdaacgiltarggmtshaavvargmgkccvsgcgdmvirgksfklngsvfregdyitidg skgliyagklkl
Timeline for d2x0sa2: