Lineage for d2x0sa1 (2x0s A:538-903)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2088020Superfamily c.1.12: Phosphoenolpyruvate/pyruvate domain [51621] (8 families) (S)
  5. 2088170Family c.1.12.2: Pyruvate phosphate dikinase, C-terminal domain [51629] (1 protein)
    automatically mapped to Pfam PF02896
  6. 2088171Protein Pyruvate phosphate dikinase, C-terminal domain [51630] (3 species)
  7. 2088183Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [75089] (1 PDB entry)
  8. 2088184Domain d2x0sa1: 2x0s A:538-903 [169774]
    Other proteins in same PDB: d2x0sa2, d2x0sa3

Details for d2x0sa1

PDB Entry: 2x0s (more details), 3 Å

PDB Description: 3.0 a resolution crystal structure of glycosomal pyruvate phosphate dikinase from trypanosoma brucei
PDB Compounds: (A:) pyruvate phosphate dikinase

SCOPe Domain Sequences for d2x0sa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2x0sa1 c.1.12.2 (A:538-903) Pyruvate phosphate dikinase, C-terminal domain {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
rspdlkgsfqtilqwcqemkrlgvrtnadtpadaakarsfgaegvglcrtehmffegsri
nfiremiladsasgrkaaldkllpiqradfvgilramrglpvtirlldpplhefvphdaa
aqfelaqklgmpaekvrnrvnalhelnpmlghrgcrlgitypeiynmqvraiieaaiavs
eegssvipeimvplvgkkeelslireevvktaeavitksgkrvhytvgtmievpraavta
dsiaqkadffsfgtndltqmgcgfsrddagpflrhygnlgiyaqdpfqsidqegigelvr
iavtkgrrvkpmlkmgicgehggdpatigfchkvgldyvscspfrvpvaivaaahasikd
rraamk

SCOPe Domain Coordinates for d2x0sa1:

Click to download the PDB-style file with coordinates for d2x0sa1.
(The format of our PDB-style files is described here.)

Timeline for d2x0sa1: