SCOPe 2.08: Domain d2x0rb2: 2x0r B:163-330

Lineage for d2x0rb2 (2x0r B:163-330)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
   unusual fold, defines family

4. Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families)

5. Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
   N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
   automatically mapped to Pfam PF02866

6. Protein Malate dehydrogenase [56329] (12 species)

7. Species Haloarcula marismortui [TaxId:2238] [56335] (6 PDB entries)

8. Domain d2x0rb2: 2x0r B:163-330 [169773]
   Other proteins in same PDB: d2x0ra1, d2x0rb1
   complexed with cl, na, nad; mutant

Details for d2x0rb2

PDB Entry: 2x0r, 2.92 Å

PDB Description: r207s, r292s mutant of malate dehydrogenase from the halophilic archeon haloarcula marismortui (holoform)

PDB Compounds: (B:) malate dehydrogenase

SCOPe Domain Sequences for d2x0rb2:

Sequence; same for both SEQRES and ATOM records:

>d2x0rb2 d.162.1.1 (B:163-330) Malate dehydrogenase {Haloarcula marismortui [TaxId: 2238]}
fggrldsarfryvlseefdapvqnvegtilgehgdaqvpvfskvsvdgtdpefsgdekeq
llgdlqesamdvierkgatewgpargvahmveailhdtgevlpasvklegefghedtafg
vpvslgsngveeivewdlddyeqdlmadaaeklsdqydkis

Timeline for d2x0rb2:

• d2x0rb2 first appeared in SCOPe 2.01
  
• d2x0rb2 appears in SCOPe 2.07