SCOPe 2.01: Domain d2x0rb1: 2x0r B:22-162

Lineage for d2x0rb1 (2x0r B:22-162)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.5: LDH N-terminal domain-like [51848] (8 proteins)

6. Protein Malate dehydrogenase [51849] (12 species)

7. Species Haloarcula marismortui [TaxId:2238] [51855] (8 PDB entries)

8. Domain d2x0rb1: 2x0r B:22-162 [169772]
   Other proteins in same PDB: d2x0ra2, d2x0rb2
   complexed with cl, na, nad; mutant

Details for d2x0rb1

PDB Entry: 2x0r, 2.92 Å

PDB Description: r207s, r292s mutant of malate dehydrogenase from the halophilic archeon haloarcula marismortui (holoform)

PDB Compounds: (B:) malate dehydrogenase

SCOPe Domain Sequences for d2x0rb1:

Sequence; same for both SEQRES and ATOM records:

>d2x0rb1 c.2.1.5 (B:22-162) Malate dehydrogenase {Haloarcula marismortui [TaxId: 2238]}
tkvsvvgaagtvgaaagynialrdiadevvfvdipdkeddtvgqaadtnhgiaydsntrv
rqggyedtagsdvvvitagiprqpgqtridlagdnapimediqssldehnddyislttsn
pvdllnrhlyeagdrsreqvig

Timeline for d2x0rb1:

• d2x0rb1 is new in SCOPe 2.01-stable
  
• d2x0rb1 appears in SCOPe 2.02
  
• d2x0rb1 appears in the current release, SCOPe 2.08