Lineage for d2x0nq1 (2x0n Q:1-164,Q:334-358)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2449371Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2449372Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2451891Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
    family members also share a common alpha+beta fold in C-terminal domain
  6. 2452132Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (21 species)
  7. 2452337Species Trypanosoma brucei brucei, glycosome [TaxId:5702] [51808] (1 PDB entry)
  8. 2452342Domain d2x0nq1: 2x0n Q:1-164,Q:334-358 [169766]
    Other proteins in same PDB: d2x0na2, d2x0nb2, d2x0no2, d2x0np2, d2x0nq2, d2x0nr2
    complexed with nad, so4

Details for d2x0nq1

PDB Entry: 2x0n (more details), 3.2 Å

PDB Description: structure of glycosomal glyceraldehyde-3-phosphate dehydrogenase from trypanosoma brucei determined from laue data
PDB Compounds: (Q:) glyceraldehyde-3-phosphate dehydrogenase, glycosomal

SCOPe Domain Sequences for d2x0nq1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2x0nq1 c.2.1.3 (Q:1-164,Q:334-358) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Trypanosoma brucei brucei, glycosome [TaxId: 5702]}
tikvgingfgrigrmvfqalcddgllgneidvvavvdmntdaryfayqmkydsvhgkfkh
svsttkskpsvakddtlvvnghrilcvkaqrnpadlpwgklgveyviestglftvksaae
ghlrggarkvvisapasggaktfvmgvnhnnynpreqhvvsnasXnewgyshrvvdlvrh
maardraakl

SCOPe Domain Coordinates for d2x0nq1:

Click to download the PDB-style file with coordinates for d2x0nq1.
(The format of our PDB-style files is described here.)

Timeline for d2x0nq1: