Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins) family members also share a common alpha+beta fold in C-terminal domain |
Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (19 species) |
Species Trypanosoma brucei brucei, glycosome [TaxId:5702] [51808] (1 PDB entry) |
Domain d2x0np1: 2x0n P:1-164,P:334-358 [169764] Other proteins in same PDB: d2x0na2, d2x0nb2, d2x0no2, d2x0np2, d2x0nq2, d2x0nr2 complexed with nad, so4 |
PDB Entry: 2x0n (more details), 3.2 Å
SCOPe Domain Sequences for d2x0np1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2x0np1 c.2.1.3 (P:1-164,P:334-358) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Trypanosoma brucei brucei, glycosome [TaxId: 5702]} tikvgingfgrigrmvfqalcddgllgneidvvavvdmntdaryfayqmkydsvhgkfkh svsttkskpsvakddtlvvnghrilcvkaqrnpadlpwgklgveyviestglftvksaae ghlrggarkvvisapasggaktfvmgvnhnnynpreqhvvsnasXnewgyshrvvdlvrh maardraakl
Timeline for d2x0np1: