Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies) core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1 |
Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) N-terminal domain is the classic Rossmann-fold |
Family d.81.1.1: GAPDH-like [55348] (6 proteins) has many additional secondary structures |
Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (19 species) |
Species Trypanosoma brucei brucei, glycosome [TaxId:5702] [55356] (1 PDB entry) |
Domain d2x0no2: 2x0n O:165-333 [169763] Other proteins in same PDB: d2x0na1, d2x0nb1, d2x0no1, d2x0np1, d2x0nq1, d2x0nr1 complexed with nad, so4 |
PDB Entry: 2x0n (more details), 3.2 Å
SCOPe Domain Sequences for d2x0no2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2x0no2 d.81.1.1 (O:165-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Trypanosoma brucei brucei, glycosome [TaxId: 5702]} cttnclaplvhvlvkegfgistglmttvhsytatqktvdgvsvkdwrggraaalniipst tgaakavgmvipstqgkltgmafrvptadvsvvdltfiatrdtsikeidaalkrasktym knilgytdeelvsadfisdsrssiydskatlqnnlpnerrffkivswyd
Timeline for d2x0no2: