Lineage for d1ropa_ (1rop A:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 2917Fold a.30: ROP-like [47379] (2 superfamilies)
  4. 2918Superfamily a.30.1: ROP protein [47380] (1 family) (S)
  5. 2919Family a.30.1.1: ROP protein [47381] (1 protein)
  6. 2920Protein ROP protein [47382] (1 species)
  7. 2921Species Escherichia coli [TaxId:562] [47383] (8 PDB entries)
  8. 2924Domain d1ropa_: 1rop A: [16976]

Details for d1ropa_

PDB Entry: 1rop (more details), 1.7 Å

PDB Description: structure of the col*e1 rop protein at 1.7 angstroms resolution

SCOP Domain Sequences for d1ropa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ropa_ a.30.1.1 (A:) ROP protein {Escherichia coli}
mtkqektalnmarfirsqtltlleklneldadeqadiceslhdhadelyrsclarf

SCOP Domain Coordinates for d1ropa_:

Click to download the PDB-style file with coordinates for d1ropa_.
(The format of our PDB-style files is described here.)

Timeline for d1ropa_: