Lineage for d2x0na2 (2x0n A:165-333)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1915719Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 1915720Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
    N-terminal domain is the classic Rossmann-fold
  5. 1915721Family d.81.1.1: GAPDH-like [55348] (6 proteins)
    has many additional secondary structures
  6. 1915812Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (19 species)
  7. 1916003Species Trypanosoma brucei brucei, glycosome [TaxId:5702] [55356] (1 PDB entry)
  8. 1916004Domain d2x0na2: 2x0n A:165-333 [169759]
    Other proteins in same PDB: d2x0na1, d2x0nb1, d2x0no1, d2x0np1, d2x0nq1, d2x0nr1
    complexed with nad, so4

Details for d2x0na2

PDB Entry: 2x0n (more details), 3.2 Å

PDB Description: structure of glycosomal glyceraldehyde-3-phosphate dehydrogenase from trypanosoma brucei determined from laue data
PDB Compounds: (A:) glyceraldehyde-3-phosphate dehydrogenase, glycosomal

SCOPe Domain Sequences for d2x0na2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2x0na2 d.81.1.1 (A:165-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Trypanosoma brucei brucei, glycosome [TaxId: 5702]}
cttnclaplvhvlvkegfgistglmttvhsytatqktvdgvsvkdwrggraaalniipst
tgaakavgmvipstqgkltgmafrvptadvsvvdltfiatrdtsikeidaalkrasktym
knilgytdeelvsadfisdsrssiydskatlqnnlpnerrffkivswyd

SCOPe Domain Coordinates for d2x0na2:

Click to download the PDB-style file with coordinates for d2x0na2.
(The format of our PDB-style files is described here.)

Timeline for d2x0na2: