Lineage for d2x0ja2 (2x0j A:164-331)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2604672Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 2604673Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 2604674Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
    N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
    automatically mapped to Pfam PF02866
  6. 2604681Protein Lactate dehydrogenase [56339] (20 species)
  7. 2604682Species Archaeoglobus fulgidus [TaxId:2234] [111253] (4 PDB entries)
    Uniprot O08349
  8. 2604686Domain d2x0ja2: 2x0j A:164-331 [169757]
    Other proteins in same PDB: d2x0ja1
    complexed with ena, so4

Details for d2x0ja2

PDB Entry: 2x0j (more details), 2.79 Å

PDB Description: 2.8 a resolution structure of malate dehydrogenase from archaeoglobus fulgidus in complex with etheno-nad
PDB Compounds: (A:) malate dehydrogenase

SCOPe Domain Sequences for d2x0ja2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2x0ja2 d.162.1.1 (A:164-331) Lactate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]}
gnqldsqrlkerlynagarnirrawiigehgdsmfvaksladfdgevdweavendvrfva
aevikrkgatifgpavaiyrmvkavvedtgeiiptsmilqgeygienvavgvpaklgkng
aevadiklsdeeieklrnsakilrerleelgy

SCOPe Domain Coordinates for d2x0ja2:

Click to download the PDB-style file with coordinates for d2x0ja2.
(The format of our PDB-style files is described here.)

Timeline for d2x0ja2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2x0ja1