Lineage for d1nkda_ (1nkd A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2709045Fold a.30: ROP-like [47379] (8 superfamilies)
    4 helices; dimer of identical alpha-hairpin subunits; bundle, closed, left-handed twist
  4. 2709046Superfamily a.30.1: ROP protein [47380] (1 family) (S)
    automatically mapped to Pfam PF01815
  5. 2709047Family a.30.1.1: ROP protein [47381] (1 protein)
  6. 2709048Protein ROP protein [47382] (1 species)
  7. 2709049Species Escherichia coli [TaxId:562] [47383] (18 PDB entries)
    Uniprot P03051
  8. 2709050Domain d1nkda_: 1nkd A: [16974]
    mutant

Details for d1nkda_

PDB Entry: 1nkd (more details), 1.09 Å

PDB Description: atomic resolution (1.07 angstroms) structure of the rop mutant <2aa>
PDB Compounds: (A:) rop

SCOPe Domain Sequences for d1nkda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nkda_ a.30.1.1 (A:) ROP protein {Escherichia coli [TaxId: 562]}
mtkqektalnmarfirsqtltlleklneladaadeqadiceslhdhadelyrsclarfg

SCOPe Domain Coordinates for d1nkda_:

Click to download the PDB-style file with coordinates for d1nkda_.
(The format of our PDB-style files is described here.)

Timeline for d1nkda_: