SCOPe 2.08: Domain d2wzma_: 2wzm A:

Lineage for d2wzma_ (2wzm A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families)

5. Family c.1.7.0: automated matches [191491] (1 protein)
   not a true family

6. Protein automated matches [190793] (31 species)
   not a true protein

7. Species Mycobacterium smegmatis [TaxId:246196] [189236] (2 PDB entries)

8. Domain d2wzma_: 2wzm A: [169727]
   automated match to d1mzra_
   complexed with na7

Details for d2wzma_

PDB Entry: 2wzm, 1.64 Å

PDB Description: crystal structure of a mycobacterium aldo-keto reductase in its apo and liganded form

PDB Compounds: (A:) aldo-keto reductase

SCOPe Domain Sequences for d2wzma_:

Sequence; same for both SEQRES and ATOM records:

>d2wzma_ c.1.7.0 (A:) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
aiptvtlnddntlpvvgigvgelsdseaersvsaaleagyrlidtaaaygneaavgraia
asgiprdeiyvttklatpdqgftssqaaaraslerlgldyvdlylihwpggdtskyvdsw
gglmkvkedgiarsigvcnfgaedletivsltyftpavnqielhpllnqaalrevnagyn
ivteaygplgvgrlldhpavtaiaeahgrtaaqvllrwsiqlgnvvisrsanperiasnl
dvfgfeltademetlnglddgtrfrpdpatytgs

Timeline for d2wzma_:

• d2wzma_ first appeared in SCOPe 2.01
  
• d2wzma_ appears in SCOPe 2.07