SCOPe 2.08: Domain d2wyuc_: 2wyu C:

Lineage for d2wyuc_ (2wyu C:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins)
   also known as short-chain dehydrogenases and SDR family
   parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
   has additional subdomain(s) that are not in the common domain
   

6. Protein automated matches [190085] (59 species)
   not a true protein

7. Species Thermus thermophilus HB8 [TaxId:300852] [187188] (4 PDB entries)

8. Domain d2wyuc_: 2wyu C: [169708]
   automated match to d1ulud_
   complexed with gol, na

Details for d2wyuc_

PDB Entry: 2wyu, 1.5 Å

PDB Description: high resolution structure of thermus thermophilus enoyl-acyl carrier protein reductase apo-form

PDB Compounds: (C:) enoyl-[acyl carrier protein] reductase

SCOPe Domain Sequences for d2wyuc_:

Sequence; same for both SEQRES and ATOM records:

>d2wyuc_ c.2.1.2 (C:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
mltvdlsgkkalvmgvtnqrslgfaiaaklkeagaevalsyqaerlrpeaeklaealgga
llfradvtqdeeldalfagvkeafggldylvhaiafapreamegryidtrrqdwllalev
sayslvavarraepllregggivtltyyasekvvpkynvmaiakaaleasvrylayelgp
kgvrvnaisagpvrtvaarsipgftkmydrvaqtaplrrnitqeevgnlglfllsplasg
itgevvyvdagyhimgme

Timeline for d2wyuc_:

• d2wyuc_ first appeared in SCOPe 2.01
  
• d2wyuc_ appears in SCOPe 2.07