Lineage for d2wytf_ (2wyt F:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1769113Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families) (S)
    has additional strand at N-terminus
  5. 1769114Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (3 proteins)
  6. 1769127Protein Cu,Zn superoxide dismutase, SOD [49331] (16 species)
  7. 1769229Species Human (Homo sapiens) [TaxId:9606] [49333] (71 PDB entries)
  8. 1769233Domain d2wytf_: 2wyt F: [169705]
    automated match to d1hl4a_
    complexed with act, cl, cu, so4, zn; mutant

Details for d2wytf_

PDB Entry: 2wyt (more details), 1 Å

PDB Description: 1.0 a resolution structure of l38v sod1 mutant
PDB Compounds: (F:) Superoxide dismutase [Cu-Zn]

SCOPe Domain Sequences for d2wytf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wytf_ b.1.8.1 (F:) Cu,Zn superoxide dismutase, SOD {Human (Homo sapiens) [TaxId: 9606]}
atkavcvlkgdgpvqgiinfeqkesngpvkvwgsikgvteglhgfhvhefgdntagctsa
gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhciigrtlvvh
ekaddlgkggneestktgnagsrlacgvigiaq

SCOPe Domain Coordinates for d2wytf_:

Click to download the PDB-style file with coordinates for d2wytf_.
(The format of our PDB-style files is described here.)

Timeline for d2wytf_: