Lineage for d2wynd_ (2wyn D:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004058Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 2004059Superfamily a.102.1: Six-hairpin glycosidases [48208] (10 families) (S)
  5. 2004268Family a.102.1.9: Trehalase-like [158742] (2 protein domains)
    Pham PF01204
    automatically mapped to Pfam PF01204
  6. 2004272Protein automated matches [190737] (1 species)
    not a true protein
  7. 2004273Species Escherichia coli K-12 [TaxId:83333] [187915] (3 PDB entries)
  8. 2004278Domain d2wynd_: 2wyn D: [169702]
    automated match to d2jf4a1
    complexed with ca, glc, lg9, so4

Details for d2wynd_

PDB Entry: 2wyn (more details), 2.1 Å

PDB Description: structure of family 37 trehalase from escherichia coli in complex with a casuarine-6-o-a-d-glucoside analogue
PDB Compounds: (D:) periplasmic trehalase

SCOPe Domain Sequences for d2wynd_:

Sequence, based on SEQRES records: (download)

>d2wynd_ a.102.1.9 (D:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
tpvtpqppdillgplfndvqnaklfpdqktfadavpnsdplmiladyrmqqnqsgfdlrh
fvnvnftlpkegekyvppegqslrehidglwpvltrstentekwdsllplpepyvvpggr
frevyywdsyftmlglaesghwdkvadmvanfaheidtyghipngnrsyylsrsqppffa
lmvellaqhegdaalkqylpqmqkeyaywmdgvenlqagqqekrvvklqdgtllnrywdd
rdtprpeswvediataksnpnrpateiyrdlrsaaasgwdfssrwmdnpqqlntlrttsi
vpvdlnslmfkmekilaraskaagdnamanqyetlanarqkgiekylwndqqgwyadydl
kshkvrnqltaaalfplyvnaaakdrankmatatkthllqpgglnttsvksgqqwdapng
waplqwvateglqnygqkevamdiswhfltnvqhtydrekklvekydvsttgtgggggey
plqdgfgwtngvtlkmldlicpkeqpcdnvpatr

Sequence, based on observed residues (ATOM records): (download)

>d2wynd_ a.102.1.9 (D:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
tpvtpqppdillgplfndvqnaklfpdqktfadavpnsdplmiladyrmqqnqsgfdlrh
fvnvnftlpkkyvppegqslrehidglwpvltrstentekwdsllplpepyvvpggrfre
vyywdsyftmlglaesghwdkvadmvanfaheidtyghipngnrsyylsrsqppffalmv
ellaqhegdaalkqylpqmqkeyaywmdgvenlqagqqekrvvklqdgtllnrywddrdt
prpeswvediataksnpnrpateiyrdlrsaaasgwdfssrwmdnpqqlntlrttsivpv
dlnslmfkmekilaraskaagdnamanqyetlanarqkgiekylwndqqgwyadydlksh
kvrnqltaaalfplyvnaaakdrankmatatkthllqpgglnttsvksgqqwdapngwap
lqwvateglqnygqkevamdiswhfltnvqhtydrekklvekydvsttyplqdgfgwtng
vtlkmldlicpkeqpcdnvpatr

SCOPe Domain Coordinates for d2wynd_:

Click to download the PDB-style file with coordinates for d2wynd_.
(The format of our PDB-style files is described here.)

Timeline for d2wynd_: