Class b: All beta proteins [48724] (174 folds) |
Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (33 families) |
Family b.18.1.16: PA-IL, galactose-binding lectin 1 [82022] (1 protein) a truncated form of this fold lacking one of the N-terminal strands |
Protein PA-IL, galactose-binding lectin 1 [82023] (1 species) |
Species Pseudomonas aeruginosa [TaxId:287] [82024] (6 PDB entries) |
Domain d2wyfd_: 2wyf D: [169692] automated match to d1l7la_ complexed with ca, gla |
PDB Entry: 2wyf (more details), 2.4 Å
SCOPe Domain Sequences for d2wyfd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wyfd_ b.18.1.16 (D:) PA-IL, galactose-binding lectin 1 {Pseudomonas aeruginosa [TaxId: 287]} awkgevlanneagqvtsiiynpgdvitivaagwasygptqkwgpqgdrehpdqglichda fcgalvmkignsgtipvntglfrwvapnnvqgaitliyndvpgtygnnsgsfsvnigkdq s
Timeline for d2wyfd_: