Lineage for d2wyfa_ (2wyf A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2774100Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2774101Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2774647Family b.18.1.16: PA-IL, galactose-binding lectin 1 [82022] (1 protein)
    a truncated form of this fold lacking one of the N-terminal strands
    automatically mapped to Pfam PF07828
  6. 2774648Protein PA-IL, galactose-binding lectin 1 [82023] (1 species)
  7. 2774649Species Pseudomonas aeruginosa [TaxId:287] [82024] (21 PDB entries)
  8. 2774753Domain d2wyfa_: 2wyf A: [169689]
    automated match to d1l7la_
    complexed with ca, gla

Details for d2wyfa_

PDB Entry: 2wyf (more details), 2.4 Å

PDB Description: crystal structure of pa-il lectin complexed with agal12bgal-o-met at 2.4 a resolution
PDB Compounds: (A:) PA-I galactophilic lectin

SCOPe Domain Sequences for d2wyfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wyfa_ b.18.1.16 (A:) PA-IL, galactose-binding lectin 1 {Pseudomonas aeruginosa [TaxId: 287]}
awkgevlanneagqvtsiiynpgdvitivaagwasygptqkwgpqgdrehpdqglichda
fcgalvmkignsgtipvntglfrwvapnnvqgaitliyndvpgtygnnsgsfsvnigkdq
s

SCOPe Domain Coordinates for d2wyfa_:

Click to download the PDB-style file with coordinates for d2wyfa_.
(The format of our PDB-style files is described here.)

Timeline for d2wyfa_: