Lineage for d2wy8a_ (2wy8 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2722035Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 2722506Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (5 families) (S)
  5. 2722786Family a.102.4.4: Complement components [48251] (4 proteins)
    probably related to other families, but has no known enzymatic activity
  6. 2722790Protein Thio-ester containing domain (TED) from Complement C3, aka C3d or C3dg [48252] (2 species)
  7. 2722791Species Human (Homo sapiens) [TaxId:9606] [48253] (19 PDB entries)
  8. 2722792Domain d2wy8a_: 2wy8 A: [169688]
    automated match to d1ghqa_
    complexed with gol

Details for d2wy8a_

PDB Entry: 2wy8 (more details), 1.7 Å

PDB Description: Staphylococcus aureus complement subversion protein Sbi-IV in complex with complement fragment C3d
PDB Compounds: (A:) complement c3d fragment

SCOPe Domain Sequences for d2wy8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wy8a_ a.102.4.4 (A:) Thio-ester containing domain (TED) from Complement C3, aka C3d or C3dg {Human (Homo sapiens) [TaxId: 9606]}
daerlkhlivtpsgageqnmigmtptviavhyldeteqwekfglekrqgalelikkgytq
qlafrqpssafaafvkrapstwltayvvkvfslavnliaidsqvlcgavkwlilekqkpd
gvfqedapvihqemigglrnnnekdmaltafvlislqeakdiceeqvnslpgsitkagdf
leanymnlqrsytvaiagyalaqmgrlkgpllnkflttakdknrwedpgkqlynveatsy
allallqlkdfdfvppvvrwlneqryygggygstqatfmvfqalaqyqkdap

SCOPe Domain Coordinates for d2wy8a_:

Click to download the PDB-style file with coordinates for d2wy8a_.
(The format of our PDB-style files is described here.)

Timeline for d2wy8a_: