| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.102: alpha/alpha toroid [48207] (6 superfamilies) multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies |
Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (5 families) ![]() |
| Family a.102.4.4: Complement components [48251] (4 proteins) probably related to other families, but has no known enzymatic activity |
| Protein Thio-ester containing domain (TED) from Complement C3, aka C3d or C3dg [48252] (2 species) |
| Species Human (Homo sapiens) [TaxId:9606] [48253] (19 PDB entries) |
| Domain d2wy7a_: 2wy7 A: [169687] automated match to d1ghqa_ complexed with gol |
PDB Entry: 2wy7 (more details), 1.7 Å
SCOPe Domain Sequences for d2wy7a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wy7a_ a.102.4.4 (A:) Thio-ester containing domain (TED) from Complement C3, aka C3d or C3dg {Human (Homo sapiens) [TaxId: 9606]}
aerlkhlivtpsgageqnmigmtptviavhyldeteqwekfglekrqgalelikkgytqq
lafrqpssafaafvkrapstwltayvvkvfslavnliaidsqvlcgavkwlilekqkpdg
vfqedapvihqemigglrnnnekdmaltafvlislqeakdiceeqvnslpgsitkagdfl
eanymnlqrsytvaiagyalaqmgrlkgpllnkflttakdknrwedpgkqlynveatsya
llallqlkdfdfvppvvrwlneqryygggygstqatfmvfqalaqyqkdap
Timeline for d2wy7a_: