Lineage for d2wy4a_ (2wy4 A:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1074917Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1074918Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1077287Family a.1.1.0: automated matches [191420] (1 protein)
    not a true family
  6. 1077288Protein automated matches [190590] (12 species)
    not a true protein
  7. 1077292Species Campylobacter jejuni [TaxId:197] [187859] (2 PDB entries)
  8. 1077293Domain d2wy4a_: 2wy4 A: [169686]
    automated match to d1vhba_
    complexed with cyn, hem

Details for d2wy4a_

PDB Entry: 2wy4 (more details), 1.35 Å

PDB Description: structure of bacterial globin from campylobacter jejuni at 1.35 a resolution
PDB Compounds: (A:) single domain haemoglobin

SCOPe Domain Sequences for d2wy4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wy4a_ a.1.1.0 (A:) automated matches {Campylobacter jejuni [TaxId: 197]}
tkeqiqiikdcvpilqkngedltnefykimfndypevkpmfnmekqisgeqpkalamail
maaknienlenmrsfvdkvaithvnlgvkeehypivgacllkaiknllnpdeatlkawev
aygkiakfyidiekklydk

SCOPe Domain Coordinates for d2wy4a_:

Click to download the PDB-style file with coordinates for d2wy4a_.
(The format of our PDB-style files is described here.)

Timeline for d2wy4a_: