Class a: All alpha proteins [46456] (284 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.0: automated matches [191420] (1 protein) not a true family |
Protein automated matches [190590] (12 species) not a true protein |
Species Campylobacter jejuni [TaxId:197] [187859] (2 PDB entries) |
Domain d2wy4a_: 2wy4 A: [169686] automated match to d1vhba_ complexed with cyn, hem |
PDB Entry: 2wy4 (more details), 1.35 Å
SCOPe Domain Sequences for d2wy4a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wy4a_ a.1.1.0 (A:) automated matches {Campylobacter jejuni [TaxId: 197]} tkeqiqiikdcvpilqkngedltnefykimfndypevkpmfnmekqisgeqpkalamail maaknienlenmrsfvdkvaithvnlgvkeehypivgacllkaiknllnpdeatlkawev aygkiakfyidiekklydk
Timeline for d2wy4a_: