SCOPe 2.07: Domain d2wxba_: 2wxb A:

Lineage for d2wxba_ (2wxb A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.73: Carbamate kinase-like [53632] (1 superfamily)
   3 layers: a/b/a; mixed (mainly parallel) beta-sheet of 8 strands, order 34215786; strand 8 is antiparallel to the rest

4. Superfamily c.73.1: Carbamate kinase-like [53633] (4 families)
   the sheet topology is similar to those of undecaprenyl diphosphate synthase and the N-terminal domain of phosphoglycerate kinase

5. Family c.73.1.2: N-acetyl-l-glutamate kinase [75297] (2 proteins)

6. Protein automated matches [190527] (4 species)
   not a true protein

7. Species Escherichia coli [TaxId:469008] [189333] (2 PDB entries)

8. Domain d2wxba_: 2wxb A: [169681]
   automated match to d1gs5a_
   complexed with act, dtu, edo

Details for d2wxba_

PDB Entry: 2wxb, 2 Å

PDB Description: acetylglutamate kinase from escherichia coli free of substrates

PDB Compounds: (A:) acetylglutamate kinase

SCOPe Domain Sequences for d2wxba_:

Sequence; same for both SEQRES and ATOM records:

>d2wxba_ c.73.1.2 (A:) automated matches {Escherichia coli [TaxId: 469008]}
mnpliiklggvlldseealerlfsalvnyreshqrplvivhgggcvvdelmkglnlpvkk
knglrvtpadqidiitgalagtanktllawakkhqiaavglflgdgdsvkvtqldeelgh
vglaqpgspklinsllengylpvvssigvtdegqlmnvnadqaatalaatlgadlillsd
vsgildgkgqriaemtaakaeqlieqgiitdgmivkvnaaldaartlgrpvdiaswrhae
qlpalfngmpmgtrila

Timeline for d2wxba_:

• d2wxba_ first appeared in SCOPe 2.01
  
• d2wxba_ appears in SCOPe 2.06
  
• d2wxba_ appears in the current release, SCOPe 2.08