Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.73: Carbamate kinase-like [53632] (1 superfamily) 3 layers: a/b/a; mixed (mainly parallel) beta-sheet of 8 strands, order 34215786; strand 8 is antiparallel to the rest |
Superfamily c.73.1: Carbamate kinase-like [53633] (4 families) the sheet topology is similar to those of undecaprenyl diphosphate synthase and the N-terminal domain of phosphoglycerate kinase |
Family c.73.1.2: N-acetyl-l-glutamate kinase [75297] (2 proteins) |
Protein automated matches [190527] (4 species) not a true protein |
Species Escherichia coli [TaxId:469008] [189333] (2 PDB entries) |
Domain d2wxba_: 2wxb A: [169681] automated match to d1gs5a_ complexed with act, dtu, edo |
PDB Entry: 2wxb (more details), 2 Å
SCOPe Domain Sequences for d2wxba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wxba_ c.73.1.2 (A:) automated matches {Escherichia coli [TaxId: 469008]} mnpliiklggvlldseealerlfsalvnyreshqrplvivhgggcvvdelmkglnlpvkk knglrvtpadqidiitgalagtanktllawakkhqiaavglflgdgdsvkvtqldeelgh vglaqpgspklinsllengylpvvssigvtdegqlmnvnadqaatalaatlgadlillsd vsgildgkgqriaemtaakaeqlieqgiitdgmivkvnaaldaartlgrpvdiaswrhae qlpalfngmpmgtrila
Timeline for d2wxba_: