Lineage for d2wwwd_ (2www D:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2113903Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2113904Protein automated matches [190123] (130 species)
    not a true protein
  7. 2114207Species Human (Homo sapiens) [TaxId:9606] [186862] (124 PDB entries)
  8. 2114363Domain d2wwwd_: 2www D: [169675]
    automated match to d2qm7b1
    complexed with 2pe, gdp

Details for d2wwwd_

PDB Entry: 2www (more details), 2.64 Å

PDB Description: Crystal Structure of Methylmalonic Acidemia Type A Protein
PDB Compounds: (D:) methylmalonic aciduria type a protein, mitochondrial

SCOPe Domain Sequences for d2wwwd_:

Sequence, based on SEQRES records: (download)

>d2wwwd_ c.37.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dhteglsdkeqrfvdklytgliqgqraclaeaitlvesthsrkkelaqvllqkvllyhre
qeqsnkgkplafrvglsgppgagkstfieyfgkmlterghklsvlavdpssctsggsllg
dktrmtelsrdmnayirpsptrgtlggvtrttneaillcegagydiilietvgvgqsefa
vadmvdmfvlllppaggdelqgikrgiiemadlvavtksdgdlivparriqaeyvsalkl
lrkrsqvwkpkvirisarsgegisemwdkmkdfqdlmlasgeltakrrkqqkvwmwnliq
esvlehfrthptvreqiplleqkvligalspglaadfllkafks

Sequence, based on observed residues (ATOM records): (download)

>d2wwwd_ c.37.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dhteglsdkeqrfvdklytgliqgqraclaeaitlvesthsrkkelaqvllqkvllyhre
qeqsnkgkplafrvglsgppgagkstfieyfgkmlterghklsvlavdpstelsrdmnay
irpsptrttneaillcegagydiilietvgvgqsefavadmvdmfvlllppaikrgiiem
adlvavtksdgdlivparriqaeyvsalkllrkrsqvwkpkvirisarsgegisemwdkm
kdfqdlmlasgeltakrrkqqkvwmwnliqesvlehfrthptvreqiplleqkvligals
pglaadfllkafks

SCOPe Domain Coordinates for d2wwwd_:

Click to download the PDB-style file with coordinates for d2wwwd_.
(The format of our PDB-style files is described here.)

Timeline for d2wwwd_: