Lineage for d2wwoa_ (2wwo A:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 936733Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families) (S)
    has additional strand at N-terminus
  5. 936734Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (3 proteins)
  6. 937129Protein automated matches [190916] (7 species)
    not a true protein
  7. 937147Species Yersinia pseudotuberculosis [TaxId:633] [189541] (2 PDB entries)
  8. 937148Domain d2wwoa_: 2wwo A: [169670]
    automated match to d1eqwa_
    complexed with gol, mes, zn

Details for d2wwoa_

PDB Entry: 2wwo (more details), 2.4 Å

PDB Description: yersinia pseudotuberculosis superoxide dismutase c
PDB Compounds: (A:) Superoxide dismutase [Cu-Zn]

SCOPe Domain Sequences for d2wwoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wwoa_ b.1.8.1 (A:) automated matches {Yersinia pseudotuberculosis [TaxId: 633]}
ndkasmtvkineslpqgngkalgtvtvtetaygllftphltglapgihgfhlhekpscap
gmkdgkavpalaagghldpnktgvhlgpyndkghlgdlpglvvnadgtatypvlaprlks
lsevkqhalmihaggdnysdhpmplggggarmacgvie

SCOPe Domain Coordinates for d2wwoa_:

Click to download the PDB-style file with coordinates for d2wwoa_.
(The format of our PDB-style files is described here.)

Timeline for d2wwoa_: