SCOPe 2.05: Domain d2wwnb_: 2wwn B:

Lineage for d2wwnb_ (2wwn B:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families)
   has additional strand at N-terminus

5. Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (3 proteins)

6. Protein automated matches [190916] (9 species)
   not a true protein

7. Species Yersinia pseudotuberculosis [TaxId:633] [189541] (2 PDB entries)

8. Domain d2wwnb_: 2wwn B: [169669]
   automated match to d1eqwa_
   complexed with azi, mes, zn

Details for d2wwnb_

PDB Entry: 2wwn, 2.6 Å

PDB Description: yersinia pseudotuberculosis superoxide dismutase c with bound azide

PDB Compounds: (B:) Superoxide dismutase [Cu-Zn]

SCOPe Domain Sequences for d2wwnb_:

Sequence; same for both SEQRES and ATOM records:

>d2wwnb_ b.1.8.1 (B:) automated matches {Yersinia pseudotuberculosis [TaxId: 633]}
kasmtvkineslpqgngkalgtvtvtetaygllftphltglapgihgfhlhekpscapgm
kdgkavpalaagghldpnktgvhlgpyndkghlgdlpglvvnadgtatypvlaprlksls
evkqhalmihaggdnysdhpmplggggarmacgvie

Timeline for d2wwnb_:

• d2wwnb_ first appeared in SCOPe 2.01
  
• d2wwnb_ appears in SCOPe 2.04
  
• d2wwnb_ appears in SCOPe 2.06
  
• d2wwnb_ appears in the current release, SCOPe 2.08