![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.40: OB-fold [50198] (16 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
![]() | Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) ![]() |
![]() | Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 proteins) |
![]() | Protein automated matches [190381] (8 species) not a true protein |
![]() | Species Citrobacter freundii [TaxId:546] [189098] (1 PDB entry) |
![]() | Domain d2wv6m_: 2wv6 M: [169666] automated match to d3efxd1 complexed with edo, gol |
PDB Entry: 2wv6 (more details), 1.89 Å
SCOPe Domain Sequences for d2wv6m_:
Sequence, based on SEQRES records: (download)
>d2wv6m_ b.40.2.1 (M:) automated matches {Citrobacter freundii [TaxId: 546]} apqnitelcseyhntqiyelnkeiktyteslagyremviisfangatfqvevpgsqhles qkrplermkdtlraayftgikvsklcvwnnktpnsiaaielsn
>d2wv6m_ b.40.2.1 (M:) automated matches {Citrobacter freundii [TaxId: 546]} apqnitelcseyhntqiyelnkeiktyteslagyremviisfangatfqvevplermkdt lraayftgikvsklcvwnnktpnsiaaielsn
Timeline for d2wv6m_: