Class b: All beta proteins [48724] (180 folds) |
Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) |
Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 proteins) |
Protein automated matches [190381] (11 species) not a true protein |
Species Citrobacter freundii [TaxId:546] [189098] (1 PDB entry) |
Domain d2wv6g_: 2wv6 G: [169660] automated match to d3efxd1 complexed with edo, gol |
PDB Entry: 2wv6 (more details), 1.89 Å
SCOPe Domain Sequences for d2wv6g_:
Sequence, based on SEQRES records: (download)
>d2wv6g_ b.40.2.1 (G:) automated matches {Citrobacter freundii [TaxId: 546]} apqnitelcseyhntqiyelnkeiktyteslagyremviisfangatfqvevpgsqhles qkrplermkdtlraayftgikvsklcvwnnktpnsiaaielsn
>d2wv6g_ b.40.2.1 (G:) automated matches {Citrobacter freundii [TaxId: 546]} apqnitelcseyhntqiyelnkeiktyteslagyremviisfangatfqvevpgsqhesq krplermkdtlraayftgikvsklcvwnnktpnsiaaielsn
Timeline for d2wv6g_: