Lineage for d2ffhb1 (2ffh B:1-88)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 637916Fold a.24: Four-helical up-and-down bundle [47161] (27 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 638207Superfamily a.24.13: Domain of the SRP/SRP receptor G-proteins [47364] (1 family) (S)
  5. 638208Family a.24.13.1: Domain of the SRP/SRP receptor G-proteins [47365] (3 proteins)
  6. 638227Protein Signal sequence recognition protein Ffh [47366] (3 species)
  7. 638238Species Thermus aquaticus [TaxId:271] [47367] (18 PDB entries)
  8. 638266Domain d2ffhb1: 2ffh B:1-88 [16966]
    Other proteins in same PDB: d2ffha2, d2ffha3, d2ffhb2, d2ffhb3, d2ffhc2, d2ffhc3

Details for d2ffhb1

PDB Entry: 2ffh (more details), 3.2 Å

PDB Description: the signal sequence binding protein ffh from thermus aquaticus
PDB Compounds: (B:) protein (ffh)

SCOP Domain Sequences for d2ffhb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ffhb1 a.24.13.1 (B:1-88) Signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]}
mfqqlsarlqeaigrlrgrgriteedlkatlreirralmdadvnlevtrdfvervreeal
gkqvlesltpaevilatvyealkealgg

SCOP Domain Coordinates for d2ffhb1:

Click to download the PDB-style file with coordinates for d2ffhb1.
(The format of our PDB-style files is described here.)

Timeline for d2ffhb1: