| Class a: All alpha proteins [46456] (171 folds) |
| Fold a.24: Four-helical up-and-down bundle [47161] (16 superfamilies) core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down |
Superfamily a.24.13: Domain of the SRP/SRP receptor G-proteins [47364] (1 family) ![]() |
| Family a.24.13.1: Domain of the SRP/SRP receptor G-proteins [47365] (2 proteins) |
| Protein Signal sequence recognition protein Ffh [47366] (2 species) |
| Species Thermus aquaticus [TaxId:271] [47367] (8 PDB entries) |
| Domain d2ffhb1: 2ffh B:1-88 [16966] Other proteins in same PDB: d2ffha2, d2ffha3, d2ffhb2, d2ffhb3, d2ffhc2, d2ffhc3 |
PDB Entry: 2ffh (more details), 3.2 Å
SCOP Domain Sequences for d2ffhb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ffhb1 a.24.13.1 (B:1-88) Signal sequence recognition protein Ffh {Thermus aquaticus}
mfqqlsarlqeaigrlrgrgriteedlkatlreirralmdadvnlevtrdfvervreeal
gkqvlesltpaevilatvyealkealgg
Timeline for d2ffhb1: