SCOPe 2.08: Domain d2ffhb1: 2ffh B:1-88

Lineage for d2ffhb1 (2ffh B:1-88)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.13: Domain of the SRP/SRP receptor G-proteins [47364] (2 families)

5. Family a.24.13.1: Domain of the SRP/SRP receptor G-proteins [47365] (3 proteins)

6. Protein Signal sequence recognition protein Ffh [47366] (3 species)

7. Species Thermus aquaticus [TaxId:271] [47367] (16 PDB entries)

8. Domain d2ffhb1: 2ffh B:1-88 [16966]
   Other proteins in same PDB: d2ffha2, d2ffha3, d2ffhb2, d2ffhb3, d2ffhc2, d2ffhc3
   complexed with cd, so4

Details for d2ffhb1

PDB Entry: 2ffh, 3.2 Å

PDB Description: the signal sequence binding protein ffh from thermus aquaticus

PDB Compounds: (B:) protein (ffh)

SCOPe Domain Sequences for d2ffhb1:

Sequence; same for both SEQRES and ATOM records:

>d2ffhb1 a.24.13.1 (B:1-88) Signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]}
mfqqlsarlqeaigrlrgrgriteedlkatlreirralmdadvnlevtrdfvervreeal
gkqvlesltpaevilatvyealkealgg

Timeline for d2ffhb1:

• d2ffhb1 first appeared (with stable ids) in SCOP 1.55
  
• d2ffhb1 appears in SCOPe 2.07