Lineage for d2wv6e_ (2wv6 E:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2058098Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2058419Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) (S)
  5. 2058420Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 proteins)
  6. 2058912Protein automated matches [190381] (8 species)
    not a true protein
  7. 2058913Species Citrobacter freundii [TaxId:546] [189098] (1 PDB entry)
  8. 2058915Domain d2wv6e_: 2wv6 E: [169658]
    automated match to d3efxd1
    complexed with edo, gol

Details for d2wv6e_

PDB Entry: 2wv6 (more details), 1.89 Å

PDB Description: crystal structure of the cholera toxin-like b-subunit from citrobacter freundii to 1.9 angstrom
PDB Compounds: (E:) cfxb

SCOPe Domain Sequences for d2wv6e_:

Sequence, based on SEQRES records: (download)

>d2wv6e_ b.40.2.1 (E:) automated matches {Citrobacter freundii [TaxId: 546]}
apqnitelcseyhntqiyelnkeiktyteslagyremviisfangatfqvevpgsqhles
qkrplermkdtlraayftgikvsklcvwnnktpnsiaaiels

Sequence, based on observed residues (ATOM records): (download)

>d2wv6e_ b.40.2.1 (E:) automated matches {Citrobacter freundii [TaxId: 546]}
apqnitelcseyhntqiyelnkeiktyteslagmviisfangatfqvekrplermkdtlr
aayftgikvsklcvwnnktpnsiaaiels

SCOPe Domain Coordinates for d2wv6e_:

Click to download the PDB-style file with coordinates for d2wv6e_.
(The format of our PDB-style files is described here.)

Timeline for d2wv6e_: