![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
![]() | Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) ![]() |
![]() | Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (5 proteins) |
![]() | Protein automated matches [190384] (21 species) not a true protein |
![]() | Species Foot-and-mouth disease virus [TaxId:12112] [189099] (2 PDB entries) |
![]() | Domain d2wv5d_: 2wv5 D: [169656] automated match to d2j92a1 |
PDB Entry: 2wv5 (more details), 2.7 Å
SCOPe Domain Sequences for d2wv5d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wv5d_ b.47.1.4 (D:) automated matches {Foot-and-mouth disease virus [TaxId: 12112]} dlqkmvmgntkpvelildgktvaiccatgvfgtaylvprhlfaekydkimldgramtdsd yrvfefeikvkgqdmlsdaalmvlhrgnkvrditkhfrdtarmkkgtpvvgvvnnadvgr lifsgealtykdivvlmdgdtmpglfaykaatragyaggavlakdgadtfivgthsaggn gvgycscvsrsmlqkmkahv
Timeline for d2wv5d_: