Lineage for d2wv5d_ (2wv5 D:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2794584Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2794585Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2797303Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (5 proteins)
  6. 2797935Protein automated matches [190384] (21 species)
    not a true protein
  7. 2797967Species Foot-and-mouth disease virus [TaxId:12112] [189099] (2 PDB entries)
  8. 2797973Domain d2wv5d_: 2wv5 D: [169656]
    automated match to d2j92a1

Details for d2wv5d_

PDB Entry: 2wv5 (more details), 2.7 Å

PDB Description: crystal structure of foot-and-mouth disease virus 3c protease in complex with a decameric peptide corresponding to the vp1-2a cleavage junction with a gln to glu substitution at p1
PDB Compounds: (D:) picornain 3c

SCOPe Domain Sequences for d2wv5d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wv5d_ b.47.1.4 (D:) automated matches {Foot-and-mouth disease virus [TaxId: 12112]}
dlqkmvmgntkpvelildgktvaiccatgvfgtaylvprhlfaekydkimldgramtdsd
yrvfefeikvkgqdmlsdaalmvlhrgnkvrditkhfrdtarmkkgtpvvgvvnnadvgr
lifsgealtykdivvlmdgdtmpglfaykaatragyaggavlakdgadtfivgthsaggn
gvgycscvsrsmlqkmkahv

SCOPe Domain Coordinates for d2wv5d_:

Click to download the PDB-style file with coordinates for d2wv5d_.
(The format of our PDB-style files is described here.)

Timeline for d2wv5d_: