Lineage for d2wv4a_ (2wv4 A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2387558Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2387559Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2389935Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (5 proteins)
  6. 2390138Protein automated matches [190384] (20 species)
    not a true protein
  7. 2390169Species Foot-and-mouth disease virus [TaxId:12112] [189099] (2 PDB entries)
  8. 2390170Domain d2wv4a_: 2wv4 A: [169651]
    automated match to d2j92a1

Details for d2wv4a_

PDB Entry: 2wv4 (more details), 2.5 Å

PDB Description: crystal structure of foot-and-mouth disease virus 3c protease in complex with a decameric peptide corresponding to the vp1-2a cleavage junction
PDB Compounds: (A:) picornain 3c

SCOPe Domain Sequences for d2wv4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wv4a_ b.47.1.4 (A:) automated matches {Foot-and-mouth disease virus [TaxId: 12112]}
dlqkmvmgntkpvelildgktvaiccatgvfgtaylvprhlfaekydkimldgramtdsd
yrvfefeikvkgqdmlsdaalmvlhrgnkvrditkhfrdtarmkkgtpvvgvvnnadvgr
lifsgealtykdivvlmdgdtmpglfaykaatragyaggavlakdgadtfivgthsaggn
gvgycscvsrsmlqkmkahvd

SCOPe Domain Coordinates for d2wv4a_:

Click to download the PDB-style file with coordinates for d2wv4a_.
(The format of our PDB-style files is described here.)

Timeline for d2wv4a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2wv4b_