SCOP 1.73: Domain d2ffha1: 2ffh A:1-88

Lineage for d2ffha1 (2ffh A:1-88)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (27 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.13: Domain of the SRP/SRP receptor G-proteins [47364] (1 family)

5. Family a.24.13.1: Domain of the SRP/SRP receptor G-proteins [47365] (3 proteins)

6. Protein Signal sequence recognition protein Ffh [47366] (3 species)

7. Species Thermus aquaticus [TaxId:271] [47367] (18 PDB entries)

8. Domain d2ffha1: 2ffh A:1-88 [16965]
   Other proteins in same PDB: d2ffha2, d2ffha3, d2ffhb2, d2ffhb3, d2ffhc2, d2ffhc3

Details for d2ffha1

PDB Entry: 2ffh, 3.2 Å

PDB Description: the signal sequence binding protein ffh from thermus aquaticus

PDB Compounds: (A:) protein (ffh)

SCOP Domain Sequences for d2ffha1:

Sequence; same for both SEQRES and ATOM records:

>d2ffha1 a.24.13.1 (A:1-88) Signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]}
mfqqlsarlqeaigrlrgrgriteedlkatlreirralmdadvnlevtrdfvervreeal
gkqvlesltpaevilatvyealkealgg

Timeline for d2ffha1:

• d2ffha1 first appeared (with stable ids) in SCOP 1.55
  
• d2ffha1 appears in SCOP 1.71
  
• d2ffha1 appears in SCOP 1.75
  
• d2ffha1 appears in the current release, SCOPe 2.08