Lineage for d2wuha_ (2wuh A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2774100Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2774101Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2774971Family b.18.1.0: automated matches [191481] (1 protein)
    not a true family
  6. 2774972Protein automated matches [190770] (51 species)
    not a true protein
  7. 2775243Species Human (Homo sapiens) [TaxId:9606] [188939] (29 PDB entries)
  8. 2775245Domain d2wuha_: 2wuh A: [169646]
    automated match to d1kexa_

Details for d2wuha_

PDB Entry: 2wuh (more details), 1.6 Å

PDB Description: crystal structure of the ddr2 discoidin domain bound to a triple-helical collagen peptide
PDB Compounds: (A:) discoidin domain receptor 2

SCOPe Domain Sequences for d2wuha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wuha_ b.18.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
npaicryplgmsggqipdeditassqwsestaakygrldseegdgawcpeipvepddlke
flqidlhtlhfitlvgtqgrhagghgiefapmykinysrdgtrwiswrnrhgkqvldgns
npydiflkdleppivarfvrfipvtdhsmnvcmrvelygcvwld

SCOPe Domain Coordinates for d2wuha_:

Click to download the PDB-style file with coordinates for d2wuha_.
(The format of our PDB-style files is described here.)

Timeline for d2wuha_: