SCOPe 2.07: Domain d2wugb_: 2wug B:

Lineage for d2wugb_ (2wug B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.0: automated matches [191404] (1 protein)
   not a true family

6. Protein automated matches [190543] (124 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:83332] [189096] (10 PDB entries)

8. Domain d2wugb_: 2wug B: [169645]
   automated match to d2puha1
   complexed with gol, hpk, scn; mutant

Details for d2wugb_

PDB Entry: 2wug, 1.8 Å

PDB Description: crystal structure of s114a mutant of hsad from mycobacterium tuberculosis in complex with hopda

PDB Compounds: (B:) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase bphd

SCOPe Domain Sequences for d2wugb_:

Sequence; same for both SEQRES and ATOM records:

>d2wugb_ c.69.1.0 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
ltfestsrfaevdvdgplklhyheagvgndqtvvllhgggpgaaswtnfsrniavlarhf
hvlavdqpgyghsdkraehgqfnryaamalkglfdqlglgrvplvgnalgggtavrfald
yparagrlvlmgpgglsinlfapdptegvkrlskfsvaptrenleaflrvmvydknlitp
elvdqrfalastpesltatramgksfagadfeagmmwrevyrlrqpvlliwgredrvnpl
dgalvalktipraqlhvfgqcghwvqvekfdefnkltieflgg

Timeline for d2wugb_:

• d2wugb_ first appeared in SCOPe 2.01
  
• d2wugb_ appears in SCOPe 2.06
  
• d2wugb_ appears in the current release, SCOPe 2.08