| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) ![]() many members have left-handed crossover connection between strand 8 and additional strand 9 |
| Family c.69.1.0: automated matches [191404] (1 protein) not a true family |
| Protein automated matches [190543] (131 species) not a true protein |
| Species Mycobacterium tuberculosis [TaxId:83332] [189096] (13 PDB entries) |
| Domain d2wuga_: 2wug A: [169644] automated match to d2puha1 complexed with gol, hpk, scn; mutant |
PDB Entry: 2wug (more details), 1.8 Å
SCOPe Domain Sequences for d2wuga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wuga_ c.69.1.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
ltfestsrfaevdvdgplklhyheagvgndqtvvllhgggpgaaswtnfsrniavlarhf
hvlavdqpgyghsdkraehgqfnryaamalkglfdqlglgrvplvgnalgggtavrfald
yparagrlvlmgpgglsinlfapdptegvkrlskfsvaptrenleaflrvmvydknlitp
elvdqrfalastpesltatramgksfagadfeagmmwrevyrlrqpvlliwgredrvnpl
dgalvalktipraqlhvfgqcghwvqvekfdefnkltieflgg
Timeline for d2wuga_: