Lineage for d3ng1b1 (3ng1 B:1-88)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 47212Fold a.29: Bromodomain-like [47363] (2 superfamilies)
  4. 47213Superfamily a.29.1: Domain of the SRP/SRP receptor G-proteins [47364] (1 family) (S)
  5. 47214Family a.29.1.1: Domain of the SRP/SRP receptor G-proteins [47365] (2 proteins)
  6. 47218Protein Signal sequence recognition protein Ffh [47366] (2 species)
  7. 47222Species Thermus aquaticus [TaxId:271] [47367] (5 PDB entries)
  8. 47227Domain d3ng1b1: 3ng1 B:1-88 [16964]
    Other proteins in same PDB: d3ng1a2, d3ng1b2

Details for d3ng1b1

PDB Entry: 3ng1 (more details), 2.3 Å

PDB Description: n and gtpase domains of the signal sequence recognition protein ffh from thermus aquaticus

SCOP Domain Sequences for d3ng1b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ng1b1 a.29.1.1 (B:1-88) Signal sequence recognition protein Ffh {Thermus aquaticus}
mfqqlsarlqeaigrlrgrgriteedlkatlreirralmdadvnlevardfvervreeal
gkqvlesltpaevilatvyealkealgg

SCOP Domain Coordinates for d3ng1b1:

Click to download the PDB-style file with coordinates for d3ng1b1.
(The format of our PDB-style files is described here.)

Timeline for d3ng1b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3ng1b2