SCOP 1.55: Domain d3ng1b1: 3ng1 B:1-88

Lineage for d3ng1b1 (3ng1 B:1-88)

1. Root: SCOP 1.55

2. Class a: All alpha proteins [46456] (138 folds)

3. Fold a.29: Bromodomain-like [47363] (2 superfamilies)

4. Superfamily a.29.1: Domain of the SRP/SRP receptor G-proteins [47364] (1 family)

5. Family a.29.1.1: Domain of the SRP/SRP receptor G-proteins [47365] (2 proteins)

6. Protein Signal sequence recognition protein Ffh [47366] (1 species)

7. Species Thermus aquaticus [TaxId:271] [47367] (5 PDB entries)

8. Domain d3ng1b1: 3ng1 B:1-88 [16964]
   Other proteins in same PDB: d3ng1a2, d3ng1b2

Details for d3ng1b1

PDB Entry: 3ng1, 2.3 Å

PDB Description: n and gtpase domains of the signal sequence recognition protein ffh from thermus aquaticus

SCOP Domain Sequences for d3ng1b1:

Sequence; same for both SEQRES and ATOM records:

>d3ng1b1 a.29.1.1 (B:1-88) Signal sequence recognition protein Ffh {Thermus aquaticus}
mfqqlsarlqeaigrlrgrgriteedlkatlreirralmdadvnlevardfvervreeal
gkqvlesltpaevilatvyealkealgg

Timeline for d3ng1b1:

• d3ng1b1 appears in SCOP 1.57
  
• d3ng1b1 appears in the current release, SCOPe 2.08