Lineage for d3ng1b1 (3ng1 B:1-88)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2699446Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 2700314Superfamily a.24.13: Domain of the SRP/SRP receptor G-proteins [47364] (2 families) (S)
  5. 2700315Family a.24.13.1: Domain of the SRP/SRP receptor G-proteins [47365] (3 proteins)
  6. 2700330Protein Signal sequence recognition protein Ffh [47366] (3 species)
  7. 2700342Species Thermus aquaticus [TaxId:271] [47367] (16 PDB entries)
  8. 2700361Domain d3ng1b1: 3ng1 B:1-88 [16964]
    Other proteins in same PDB: d3ng1a2, d3ng1b2
    complexed with cd, edo, so4

Details for d3ng1b1

PDB Entry: 3ng1 (more details), 2.3 Å

PDB Description: n and gtpase domains of the signal sequence recognition protein ffh from thermus aquaticus
PDB Compounds: (B:) signal sequence recognition protein ffh

SCOPe Domain Sequences for d3ng1b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ng1b1 a.24.13.1 (B:1-88) Signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]}
mfqqlsarlqeaigrlrgrgriteedlkatlreirralmdadvnlevardfvervreeal
gkqvlesltpaevilatvyealkealgg

SCOPe Domain Coordinates for d3ng1b1:

Click to download the PDB-style file with coordinates for d3ng1b1.
(The format of our PDB-style files is described here.)

Timeline for d3ng1b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3ng1b2