Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.80: SIS domain [53696] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 5 strands, order 21345 |
Superfamily c.80.1: SIS domain [53697] (4 families) |
Family c.80.1.0: automated matches [191405] (1 protein) not a true family |
Protein automated matches [190547] (3 species) not a true protein |
Species Mycobacterium tuberculosis [TaxId:83332] [189097] (1 PDB entry) |
Domain d2wu8a_: 2wu8 A: [169637] automated match to d1dqra_ complexed with so4 |
PDB Entry: 2wu8 (more details), 2.25 Å
SCOPe Domain Sequences for d2wu8a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wu8a_ c.80.1.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]} pditatpawdalarhhdqignthlrqffaddpgrgreltvsvgdlyidyskhrvtretla llidlartahleerrdqmfagvhintsedravlhtalrlprdaelvvdgqdvvtdvhavl damgaftdrlrsgewtgatgkristvvnigiggsdlgpvmvyqalrhyadagisarfvsn vdpadliatladldpattlfivasktfstletltnataarrwltdalgdaavsrhfvavs tnkrlvddfgintdnmfgfwdwvggrysvdsaiglslmtvigrdafadflagfhiidrhf ataplesnapvllgliglwysnffgaqsrtvlpysndlsrfpaylqqltmesngkstrad gspvsadtgeifwgepgtngqhafyqllhqgtrlvpadfigfaqplddlptaegtgsmhd llmsnffaqtqvlafgktaeeiaadgtpahvvahkvmpgnrpstsilasrltpsvlgqli alyehqvftegvvwgidsfdqwgvelgktqakallpvitgagspppqsdsstdglvrryr tergragle
Timeline for d2wu8a_: